PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00139490001
Common NameGSBRNA2T00139490001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 191aa    MW: 22264.3 Da    PI: 9.9588
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00139490001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.1e-091441791952
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrR 52 
                          Fe   ++yp+++e+  LAk+++L+++qV +WF N R
  GSBRNA2T00139490001 144 FEHflHPYPKESEKMMLAKQIRLSKNQVANWFINAR 179
                          554458****************************99 PP

2BELL118.23.8e-38273172
                 BELL  1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                         erqelq+kk kLl++l+eVdkrY+qy++q+++++ssFe+vag gsakpYts+Al++iS hFr+L+dai+e+i
  GSBRNA2T00139490001  2 ERQELQSKKDKLLTMLDEVDKRYNQYYHQMEALASSFEVVAGFGSAKPYTSVALNRISCHFRSLRDAIKEHI 73
                         79*******************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.3E-9171IPR006563POX domain
PfamPF075269.5E-33169IPR006563POX domain
SuperFamilySSF466893.64E-13117179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-20124185IPR009057Homeodomain-like
CDDcd000864.58E-7125179No hitNo description
SMARTSM003899.6E-4125189IPR001356Homeobox domain
PfamPF059201.8E-15142179IPR008422Homeobox KN domain
PROSITE profilePS5007110.608144185IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MERQELQSKK DKLLTMLDEV DKRYNQYYHQ MEALASSFEV VAGFGSAKPY TSVALNRISC  60
HFRSLRDAIK EHIQVIREKL GEKGGELSLD EQQGGERIPI LRYLDQRLRQ QRTFHQQIGM  120
VRPSWRPQRG LPESFVSGLR AWLFEHFLHP YPKESEKMML AKQIRLSKNQ VANWFINARS  180
PNSTNQEDSS *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.200695e-35leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00139490001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5705080.0AY570508.1 Arabidopsis thaliana BEL1-like homeodomain 5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013729468.11e-124PREDICTED: BEL1-like homeodomain protein 10 isoform X2
SwissprotQ9FXG81e-108BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLA0A078D8U01e-141A0A078D8U0_BRANA; BnaC08g18920D protein
STRINGBra016497.1-P1e-120(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.33e-98BEL1-like homeodomain 10
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]